Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Methyl-CpG-binding domain protein 2 |
|---|
Gene and Protein Information
| Gene ID | 8932 |
|---|---|
| Uniprot Accession IDs | Q9UBB5 O95242 Q9UIS8 |
| Ensembl ID | ENSP00000256429 |
| Symbol | DMTase NY-CO-41 |
| Sequence | MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 693801 | MBD2 | methyl-CpG binding domain protein 2 | 9544 | Inparanoid, OMA | |
| Mouse | 17191 | Mbd2 | methyl-CpG binding domain protein 2 | 10090 | MGI:1333813 | Inparanoid, OMA, EggNOG |
| Rat | 680172 | Mbd2 | methyl-CpG binding domain protein 2 | 10116 | RGD:1595452 | Inparanoid, OMA, EggNOG |
| Horse | 100070096 | MBD2 | methyl-CpG binding domain protein 2 | 9796 | VGNC:20006 | Inparanoid, OMA, EggNOG |
| Pig | 100511112 | MBD2 | methyl-CpG binding domain protein 2 | 9823 | OMA, EggNOG | |
| Opossum | 100009966 | MBD2 | methyl-CpG binding domain protein 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100216281 | mbd2 | methyl-CpG binding domain protein 2 | 8364 | XB-GENE-493776 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / Epigenetic regulator / Reader / Methyl-CpG-binding domain / Methyl-CpG-binding domain protein 2
protein / Epigenetic regulator / Reader / Methyl-CpG-binding domain / Methyl-CpG-binding domain protein 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.