Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Serine/threonine-protein kinase Nek6 |
|---|
Gene and Protein Information
| Gene ID | 10783 |
|---|---|
| Uniprot Accession IDs | Q9HC98 B7Z2D9 Q5TBG3 Q5TBG9 Q6FG86 Q6IAR3 Q96E83 Q9ULX2 |
| Ensembl ID | ENSP00000362702 |
| Symbol | SID6-1512 |
| Family | Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily. |
| Sequence | MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737739 | NEK6 | NIMA related kinase 6 | 9598 | VGNC:13922 | OMA, EggNOG |
| Macaque | 100427402 | NEK6 | NIMA related kinase 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 59126 | Nek6 | NIMA (never in mitosis gene a)-related expressed kinase 6 | 10090 | MGI:1891638 | Inparanoid, OMA, EggNOG |
| Rat | 360161 | Nek6 | NIMA-related kinase 6 | 10116 | RGD:727779 | Inparanoid, OMA, EggNOG |
| Dog | 609003 | NEK6 | NIMA related kinase 6 | 9615 | VGNC:43733 | Inparanoid, OMA |
| Horse | 100071002 | NEK6 | NIMA related kinase 6 | 9796 | VGNC:20673 | Inparanoid, OMA |
| Cow | 515816 | NEK6 | NIMA related kinase 6 | 9913 | VGNC:31997 | Inparanoid, OMA |
| Pig | 100514624 | NEK6 | NIMA related kinase 6 | 9823 | Inparanoid, OMA | |
| Chicken | 417101 | NEK6 | NIMA related kinase 6 | 9031 | CGNC:759 | Inparanoid, OMA, EggNOG |
| Xenopus | 448328 | nek6 | NIMA-related kinase 6 | 8364 | XB-GENE-956751 | Inparanoid, OMA |
| C. elegans | 181398 | nekl-3 | Serine/threonine-protein kinase nekl-3 | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.