Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | N-terminal EF-hand calcium-binding protein 3 |
|---|
Gene and Protein Information
| Gene ID | 63941 |
|---|---|
| Uniprot Accession IDs | Q96P71 A8K780 E1P5N2 Q5JWF5 Q5JWF6 Q5JWF7 Q86VV1 Q9H433 Q9H8G8 Q9HBW7 Q9HCQ9 |
| Ensembl ID | ENSP00000246190 |
| Symbol | APBA2BP NIP1 SYTIP2 XB51 NIP1 XB51 STIP3 EFCBP3 SYTIP2 APBA2BP dJ63M2.4 dJ63M2.5 |
| Sequence | MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107969995 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9598 | VGNC:6209 | Inparanoid, OMA, EggNOG |
| Macaque | 100427126 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56846 | Necab3 | N-terminal EF-hand calcium binding protein 3 | 10090 | MGI:1861721 | Inparanoid, OMA, EggNOG |
| Dog | 608658 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9615 | VGNC:43715 | Inparanoid, OMA, EggNOG |
| Horse | 100069158 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9796 | VGNC:20653 | Inparanoid, OMA, EggNOG |
| Cow | 514695 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9913 | VGNC:31979 | Inparanoid, OMA, EggNOG |
| Pig | 100620656 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9823 | OMA, EggNOG | |
| Opossum | NECAB3 | N-terminal EF-hand calcium binding protein 3 [Source:HGNC Symbol;Acc:HGNC:15851] | 13616 | Inparanoid, EggNOG | ||
| Chicken | 419154 | NECAB3 | N-terminal EF-hand calcium binding protein 3 | 9031 | CGNC:2219 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.