Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Nuclear receptor subfamily 4 group A member 1 |
|---|
Gene and Protein Information
| Gene ID | 3164 |
|---|---|
| Uniprot Accession IDs | P22736 B4DML7 Q15627 Q53Y00 Q6IBU8 |
| Ensembl ID | ENSP00000440864 |
| Symbol | GFRP1 HMR NAK1 HMR N10 TR3 NP10 GFRP1 NAK-1 NGFIB NUR77 |
| Family | Belongs to the nuclear hormone receptor family. NR4 subfamily. |
| Sequence | MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451913 | NR4A1 | nuclear receptor subfamily 4 group A member 1 | 9598 | VGNC:5507 | OMA, EggNOG |
| Macaque | 696797 | LOC696797 | nuclear receptor subfamily 4 group A member 1 | 9544 | OMA, EggNOG | |
| Mouse | 15370 | Nr4a1 | nuclear receptor subfamily 4, group A, member 1 | 10090 | MGI:1352454 | Inparanoid, OMA, EggNOG |
| Rat | 79240 | Nr4a1 | nuclear receptor subfamily 4, group A, member 1 | 10116 | RGD:620029 | Inparanoid, OMA, EggNOG |
| Dog | 403897 | NR4A1 | nuclear receptor subfamily 4 group A member 1 | 9615 | VGNC:43954 | Inparanoid, OMA, EggNOG |
| Horse | 100061353 | NR4A1 | nuclear receptor subfamily 4 group A member 1 | 9796 | VGNC:20871 | Inparanoid, OMA, EggNOG |
| Cow | 528390 | NR4A1 | nuclear receptor subfamily 4 group A member 1 | 9913 | VGNC:32245 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559576 | nr4a1 | nuclear receptor subfamily 4 group A member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779756 | nr4a1 | nuclear receptor subfamily 4 group A member 1 | 8364 | XB-GENE-483315 | Inparanoid, OMA, EggNOG |
| Zebrafish | 431720 | nr4a1 | nuclear receptor subfamily 4, group A, member 1 | 7955 | ZDB-GENE-040704-11 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.