🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CA5B

BeschreibungCarbonic anhydrase 5B, mitochondrial

Gene and Protein Information

Gene ID11238
Uniprot Accession IDs Q9Y2D0 A8K4T5
Ensembl ID ENSP00000314099
Symbol CAVB CA-VB
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque713128CA5Bcarbonic anhydrase 5B9544Inparanoid, OMA, EggNOG
Mouse56078Car5bcarbonic anhydrase 5b, mitochondrial10090MGI:1926249Inparanoid, OMA, EggNOG
Rat302669Car5bcarbonic anhydrase 5B10116RGD:1549783Inparanoid, OMA, EggNOG
Dog100856271CA5Bcarbonic anhydrase 5B9615VGNC:38613Inparanoid, OMA, EggNOG
Horse100051095LOC100051095carbonic anhydrase 5B, mitochondrial9796OMA, EggNOG
Cow514494CA5Bcarbonic anhydrase 5B9913VGNC:26655Inparanoid, OMA, EggNOG
Pig100156418CA5Bcarbonic anhydrase 5B9823OMA, EggNOG
Opossum100031763CA5Bcarbonic anhydrase 5B13616Inparanoid, OMA, EggNOG
PlatypusCA5Bcarbonic anhydrase 5B [Source:HGNC Symbol;Acc:HGNC:1378]9258OMA, EggNOG
Xenopus733981ca5bcarbonic anhydrase VB, mitochondrial8364XB-GENE-1003819Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.