CA6

BeschreibungCarbonic anhydrase 6

Gene and Protein Information

Gene ID765
Uniprot Accession IDs P23280 E7EMQ1 Q5FBW3 Q5FC00 Q96QX8 Q9UF03
Ensembl ID ENSP00000366654
Symbol CA-VI GUSTIN
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp457915CA6carbonic anhydrase 69598VGNC:9850OMA, EggNOG
Macaque709540CA6carbonic anhydrase 69544OMA, EggNOG
Mouse12353Car6carbonic anhydrase 610090MGI:1333786Inparanoid, OMA, EggNOG
Rat298657Car6carbonic anhydrase 610116RGD:70516Inparanoid, OMA, EggNOG
Dog403503CA6carbonic anhydrase 69615VGNC:38614Inparanoid, OMA, EggNOG
Horse100051818CA6carbonic anhydrase 69796VGNC:15966Inparanoid, OMA, EggNOG
Cow280742CA6carbonic anhydrase 69913VGNC:26656Inparanoid, OMA, EggNOG
Pig100240717CA6carbonic anhydrase 69823Inparanoid, OMA, EggNOG
Opossum100617216CA6carbonic anhydrase 613616Inparanoid, OMA, EggNOG
Xenopus779937ca6carbonic anhydrase 68364XB-GENE-494019Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.