CA1

BeschreibungCarbonic anhydrase 1

Gene and Protein Information

Gene ID759
Uniprot Accession IDs P00915
Ensembl ID ENSP00000430656
Symbol CAB CA-I Car1 HEL-S-11
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp464264CA1carbonic anhydrase 19598VGNC:10213Inparanoid, OMA
Macaque703701CA1carbonic anhydrase 19544Inparanoid, OMA
Mouse12346Car1carbonic anhydrase 110090MGI:88268Inparanoid, OMA
Rat310218Car1carbonic anhydrase I10116RGD:1309780Inparanoid, OMA
Dog487031CA1carbonic anhydrase 19615VGNC:38604Inparanoid, OMA
Cow510801CA1carbonic anhydrase I9913Inparanoid, OMA
Opossum497246CA1carbonic anhydrase 113616Inparanoid, OMA
Xenopus100496485ca1carbonic anhydrase I8364XB-GENE-957160Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.