🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CA3

BeschreibungCarbonic anhydrase 3

Gene and Protein Information

Gene ID761
Uniprot Accession IDs P07451 B2R867 B3KUC8 O60842
Ensembl ID ENSP00000285381
Symbol Car3 CAIII
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque703801CA3carbonic anhydrase 39544Inparanoid, OMA, EggNOG
Mouse12350Car3carbonic anhydrase 310090MGI:88270Inparanoid, OMA, EggNOG
Rat54232Car3carbonic anhydrase 310116RGD:2241Inparanoid, OMA, EggNOG
Dog487032CA3carbonic anhydrase 39615VGNC:38611Inparanoid, OMA, EggNOG
Horse100050125CA3carbonic anhydrase 39796VGNC:15964Inparanoid, OMA, EggNOG
Cow513212CA3carbonic anhydrase 39913VGNC:26653Inparanoid, OMA, EggNOG
Pig494016CA3carbonic anhydrase 39823Inparanoid, OMA, EggNOG
Opossum100018604CA3carbonic anhydrase 313616Inparanoid, OMA, EggNOG
PlatypusCA3carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]9258OMA, EggNOG
Xenopus100496328ca3carbonic anhydrase III8364XB-GENE-1007186OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.