CYP11B1

BeschreibungCytochrome P450 11B1, mitochondrial

Gene and Protein Information

Gene ID1584
Uniprot Accession IDs P15538 Q14095 Q4VAQ8 Q4VAQ9 Q9UML2
Ensembl ID ENSP00000292427
Symbol S11BH FHI CPN1 CYP11B P450C11
FamilyBelongs to the cytochrome P450 family.
Sequence
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse110115Cyp11b1cytochrome P450, family 11, subfamily b, polypeptide 110090MGI:88583Inparanoid, OMA
Dog482071CYP11B2cytochrome P450, family 11, subfamily B, polypeptide 29615Inparanoid, OMA
Opossum100032885LOC100032885cytochrome P450 11B1, mitochondrial13616Inparanoid, OMA
Anole lizard100560890LOC100560890cytochrome P450 11B, mitochondrial28377Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.