🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | B- and T-lymphocyte attenuator |
|---|
Gene and Protein Information
| Gene ID | 151888 |
|---|---|
| Uniprot Accession IDs | Q7Z6A9 Q3B831 Q3HS85 Q6ZNH9 |
| Ensembl ID | ENSP00000333919 |
| Symbol | BTLA1 CD272 |
| Sequence | MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460584 | BTLA | B and T lymphocyte associated | 9598 | VGNC:1749 | OMA, EggNOG |
| Macaque | 708202 | BTLA | B and T lymphocyte associated | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 208154 | Btla | B and T lymphocyte associated | 10090 | MGI:2658978 | Inparanoid, OMA, EggNOG |
| Rat | 407756 | Btla | B and T lymphocyte associated | 10116 | RGD:1303280 | Inparanoid, OMA, EggNOG |
| Dog | 487975 | BTLA | B and T lymphocyte associated | 9615 | VGNC:38561 | Inparanoid, OMA, EggNOG |
| Horse | 100071491 | BTLA | B and T lymphocyte associated | 9796 | VGNC:15921 | Inparanoid, OMA, EggNOG |
| Cow | 531767 | BTLA | B and T lymphocyte associated | 9913 | VGNC:26602 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.