🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Carbonic anhydrase 12 |
|---|
Gene and Protein Information
| Gene ID | 771 |
|---|---|
| Uniprot Accession IDs | O43570 B2RE24 Q53YE5 Q9BWG2 |
| Ensembl ID | ENSP00000178638 |
| Symbol | CAXII CA-XII T18816 HsT18816 |
| Family | Belongs to the alpha-carbonic anhydrase family. |
| Sequence | MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 705838 | CA12 | carbonic anhydrase 12 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 76459 | Car12 | carbonic anhydrase 12 | 10090 | MGI:1923709 | OMA, EggNOG |
| Rat | 363085 | Car12 | carbonic anhydrase 12 | 10116 | RGD:1306612 | Inparanoid, OMA, EggNOG |
| Dog | 478333 | CA12 | carbonic anhydrase 12 | 9615 | VGNC:38607 | Inparanoid, OMA, EggNOG |
| Horse | 100054028 | CA12 | carbonic anhydrase 12 | 9796 | VGNC:15961 | Inparanoid, OMA, EggNOG |
| Cow | 614323 | CA12 | carbonic anhydrase 12 | 9913 | VGNC:26650 | Inparanoid, OMA, EggNOG |
| Pig | 100152749 | CA12 | carbonic anhydrase 12 | 9823 | OMA, EggNOG | |
| Opossum | 100023076 | CA12 | carbonic anhydrase 12 | 13616 | Inparanoid, EggNOG | |
| Platypus | CA12 | carbonic anhydrase 12 [Source:HGNC Symbol;Acc:HGNC:1371] | 9258 | OMA, EggNOG | ||
| Chicken | 415370 | CA12 | carbonic anhydrase 12 | 9031 | CGNC:2518 | Inparanoid, OMA |
| Anole lizard | 100567887 | ca12 | carbonic anhydrase 12 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549185 | ca12 | carbonic anhydrase XII | 8364 | XB-GENE-1015246 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.