🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

BCDIN3D

BeschreibungPre-miRNA 5'-monophosphate methyltransferase

Gene and Protein Information

Gene ID144233
Uniprot Accession IDs Q7Z5W3 A8K829
Ensembl ID ENSP00000335201
FamilyBelongs to the methyltransferase superfamily.
Sequence
MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp741514BCDIN3DBCDIN3 domain containing RNA methyltransferase9598VGNC:8348OMA, EggNOG
Macaque711559BCDIN3DBCDIN3 domain containing RNA methyltransferase9544OMA, EggNOG
Mouse75284Bcdin3dBCDIN3 domain containing10090MGI:1922534OMA, EggNOG
Dog100685234BCDIN3DBCDIN3 domain containing RNA methyltransferase9615VGNC:38404OMA, EggNOG
Horse100059723BCDIN3DBCDIN3 domain containing RNA methyltransferase9796VGNC:15787OMA, EggNOG
Cow505650BCDIN3DBCDIN3 domain containing RNA methyltransferase9913VGNC:26442OMA, EggNOG
Opossum100022774BCDIN3DBCDIN3 domain containing RNA methyltransferase13616OMA, EggNOG
PlatypusBCDIN3DBCDIN3 domain containing RNA methyltransferase [Source:HGNC Symbol;Acc:HGNC:27050]9258OMA, EggNOG
Anole lizard100562802bcdin3dBCDIN3 domain containing RNA methyltransferase28377OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.