🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

BID

BeschreibungBH3-interacting domain death agonist

Gene and Protein Information

Gene ID637
Uniprot Accession IDs P55957 Q549M7 Q71T04 Q7Z4M9 Q8IY86
Ensembl ID ENSP00000318822
Symbol FP497
Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp458635BIDBH3 interacting domain death agonist9598VGNC:5229OMA, EggNOG
Macaque100426724BIDBH3 interacting domain death agonist9544OMA, EggNOG
Mouse12122BidBH3 interacting domain death agonist10090MGI:108093Inparanoid, OMA, EggNOG
Rat64625BidBH3 interacting domain death agonist10116RGD:620160Inparanoid, OMA, EggNOG
Dog100683675BIDBH3 interacting domain death agonist9615VGNC:38456Inparanoid, OMA, EggNOG
Horse100054988BIDBH3 interacting domain death agonist9796VGNC:15829Inparanoid, OMA, EggNOG
Cow510373BIDBH3 interacting domain death agonist9913VGNC:26496Inparanoid, OMA, EggNOG
Pig594852BIDBH3 interacting domain death agonist9823Inparanoid, OMA, EggNOG
Chicken395236BIDBH3 interacting domain death agonist9031CGNC:9863Inparanoid, OMA, EggNOG
Anole lizard100563997bidBH3 interacting domain death agonist28377Inparanoid, OMA, EggNOG
Xenopus100036674bidBH3 interacting domain death agonist8364XB-GENE-956016Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.