🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

BCL2L14

BeschreibungApoptosis facilitator Bcl-2-like protein 14

Gene and Protein Information

Gene ID79370
Uniprot Accession IDs Q9BZR8 A8KAD0 Q96QR5 Q9BZR7 Bcl2-L-14
Ensembl ID ENSP00000309132
Symbol BCLG BCLG
FamilyBelongs to the Bcl-2 family.
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp465293BCL2L14BCL2 like 149598VGNC:12794OMA, EggNOG
Macaque695971BCL2L14BCL2 like 149544Inparanoid, OMA, EggNOG
Mouse66813Bcl2l14BCL2-like 14 (apoptosis facilitator)10090MGI:1914063Inparanoid, OMA, EggNOG
Rat500348Bcl2l14BCL2 like 1410116RGD:1562777Inparanoid, OMA, EggNOG
Dog477693BCL2L14BCL2 like 149615VGNC:38410Inparanoid, OMA, EggNOG
Horse100063375BCL2L14BCL2 like 149796VGNC:15794Inparanoid, OMA, EggNOG
Cow508365BCL2L14BCL2 like 149913VGNC:26448Inparanoid, OMA, EggNOG
Pig100514901BCL2L14BCL2 like 149823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.