🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

B2M

BeschreibungBeta-2-microglobulin

Gene and Protein Information

Gene ID567
Uniprot Accession IDs P61769 P01884 Q540F8 Q6IAT8 Q9UCK0 Q9UD48 Q9UDF4
Ensembl ID ENSP00000452780
Symbol IMD43
FamilyBelongs to the beta-2-microglobulin family.
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp450170B2Mbeta-2-microglobulin9598VGNC:11825Inparanoid, OMA, EggNOG
Macaque712428B2Mbeta-2-microglobulin9544Inparanoid, OMA, EggNOG
Mouse12010B2mbeta-2 microglobulin10090MGI:88127Inparanoid, OMA, EggNOG
Rat24223B2mbeta-2 microglobulin10116RGD:2189Inparanoid, OMA, EggNOG
Dog100855741B2Mbeta-2-microglobulin9615VGNC:38331OMA, EggNOG
Horse100034203B2Mbeta-2-microglobulin9796VGNC:15722Inparanoid, OMA, EggNOG
Cow783680LOC783680beta-2-microglobulin9913OMA, EggNOG
PigB2MBeta-2-microglobulin [Source:UniProtKB/Swiss-Prot;Acc:Q07717]9823Inparanoid, OMA, EggNOG
Opossum554191B2Mbeta-2-microglobulin13616Inparanoid, EggNOG
Chicken414830B2Mbeta-2-microglobulin9031CGNC:1542Inparanoid, OMA, EggNOG
Anole lizard100560544b2mbeta-2-microglobulin28377OMA, EggNOG
Zebrafish30400b2mbeta-2-microglobulin7955ZDB-GENE-980526-88Inparanoid, OMA
Zebrafish791742b2mlbeta-2-microglobulin, like7955ZDB-GENE-040426-2136OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    defense/immunity protein    /    major histocompatibility complex antigen    /    Beta-2-microglobulin
DTO Classes
protein    /    Immune response    /    Major histocompatibility complex antigen    /    Beta-2-microglobulin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.