Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Cytochrome c oxidase assembly protein COX11, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1353 |
|---|---|
| Uniprot Accession IDs | Q9Y6N1 D3DTY5 I3L220 Q6FHB7 Q9BRX0 Q9UME8 |
| Ensembl ID | ENSP00000299335 |
| Symbol | COX11P |
| Family | Belongs to the COX11/CtaG family. |
| Sequence | MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748332 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9598 | VGNC:12146 | OMA, EggNOG |
| Macaque | 641445 | COX11 | COX11 homolog, cytochrome c oxidase assembly protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 69802 | Cox11 | cytochrome c oxidase assembly protein 11 | 10090 | MGI:1917052 | Inparanoid, OMA, EggNOG |
| Dog | 609555 | COX11 | COX11 cytochrome c oxidase assembly homolog (yeast) | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100056543 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9796 | VGNC:51473 | Inparanoid, OMA, EggNOG |
| Cow | 510509 | COX11 | COX11 cytochrome c oxidase assembly homolog (yeast) | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014890 | LOC100014890 | cytochrome c oxidase assembly protein COX11, mitochondrial | 13616 | OMA, EggNOG | |
| Chicken | 770638 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9031 | CGNC:66650 | Inparanoid, OMA |
| Anole lizard | 100566567 | LOC100566567 | cytochrome c oxidase assembly protein COX11, mitochondrial | 28377 | OMA, EggNOG | |
| Xenopus | cox11 | COX11 cytochrome c oxidase copper chaperone [Source:Xenbase;Acc:XB-GENE-6048797] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100005158 | cox11 | cytochrome c oxidase assembly homolog 11 (yeast) | 7955 | ZDB-GENE-050506-82 | Inparanoid, OMA, EggNOG |
| C. elegans | 186814 | cox-11 | Cytochrome OXidase assembly protein | 6239 | Inparanoid, OMA | |
| Fruitfly | 33776 | CG31648 | CG31648 gene product from transcript CG31648-RA | 7227 | FBgn0051648 | Inparanoid, EggNOG |
| S.cerevisiae | 855971 | COX11 | Cox11p | 4932 | S000006053 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.