🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

EGLN3

BeschreibungEgl nine homolog 3

Gene and Protein Information

Gene ID112399
Uniprot Accession IDs Q9H6Z9 Q2TA79 Q3B8N4 Q6P1R2
Ensembl ID ENSP00000250457
Symbol PHD3 HIFPH3 HIFP4H3
Sequence
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452850EGLN3egl-9 family hypoxia inducible factor 39598VGNC:10306OMA, EggNOG
Macaque717342EGLN3egl-9 family hypoxia inducible factor 39544Inparanoid, OMA, EggNOG
Mouse112407Egln3egl-9 family hypoxia-inducible factor 310090MGI:1932288Inparanoid, OMA, EggNOG
Rat54702Egln3egl-9 family hypoxia-inducible factor 310116RGD:71019Inparanoid, OMA, EggNOG
Dog480286EGLN3egl-9 family hypoxia inducible factor 39615VGNC:40241Inparanoid, OMA, EggNOG
Horse100056635EGLN3egl-9 family hypoxia inducible factor 39796VGNC:17461Inparanoid, OMA, EggNOG
Cow535578EGLN3egl-9 family hypoxia inducible factor 39913VGNC:28367Inparanoid, OMA, EggNOG
Pig100152368EGLN3egl-9 family hypoxia inducible factor 39823OMA, EggNOG
Opossum100013679EGLN3egl-9 family hypoxia inducible factor 313616Inparanoid, EggNOG
Platypus100081498EGLN3egl-9 family hypoxia inducible factor 39258Inparanoid, OMA, EggNOG
Chicken423316EGLN3egl-9 family hypoxia inducible factor 39031CGNC:7601Inparanoid, OMA, EggNOG
Anole lizard100555054egln3egl-9 family hypoxia inducible factor 328377OMA, EggNOG
Xenopus100145602egln3egl-9 family hypoxia-inducible factor 38364XB-GENE-964334Inparanoid, OMA, EggNOG
Zebrafish406602egln3egl-9 family hypoxia-inducible factor 37955ZDB-GENE-040426-2541Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.