🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Basic leucine zipper transcriptional factor ATF-like 3 |
|---|
Gene and Protein Information
| Gene ID | 55509 |
|---|---|
| Uniprot Accession IDs | Q9NR55 B-ATF-3 |
| Ensembl ID | ENSP00000243440 |
| Symbol | SNFT JDP1 SNFT JUNDM1 |
| Family | Belongs to the bZIP family. |
| Sequence | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457721 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 9598 | VGNC:11734 | OMA, EggNOG |
| Macaque | 710551 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 9544 | OMA, EggNOG | |
| Mouse | 381319 | Batf3 | basic leucine zipper transcription factor, ATF-like 3 | 10090 | MGI:1925491 | Inparanoid, OMA, EggNOG |
| Rat | 60462 | Batf3 | basic leucine zipper ATF-like transcription factor 3 | 10116 | RGD:620501 | Inparanoid, OMA, EggNOG |
| Dog | 490283 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 9615 | VGNC:38387 | Inparanoid, OMA, EggNOG |
| Horse | 100053960 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 9796 | VGNC:15772 | Inparanoid, OMA, EggNOG |
| Cow | 535008 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 9913 | VGNC:26427 | Inparanoid, OMA, EggNOG |
| Opossum | 100016641 | BATF3 | basic leucine zipper ATF-like transcription factor 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | BATF3 | basic leucine zipper ATF-like transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:28915] | 28377 | Inparanoid, EggNOG | ||
| Zebrafish | 751677 | batf3 | basic leucine zipper transcription factor, ATF-like 3 | 7955 | ZDB-GENE-041014-356 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.