🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

CDX4

BeschreibungHomeobox protein CDX-4

Gene and Protein Information

Gene ID1046
Uniprot Accession IDs O14627 A1A513 Q5JS20
Ensembl ID ENSP00000362613
FamilyBelongs to the Caudal homeobox family.
Sequence
MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp473667CDX4caudal type homeobox 49598VGNC:1401OMA, EggNOG
Macaque701374CDX4caudal type homeobox 49544Inparanoid, OMA, EggNOG
Mouse12592Cdx4caudal type homeobox 410090MGI:88362Inparanoid, OMA, EggNOG
Rat302400Cdx4caudal type homeo box 410116RGD:1561529Inparanoid, OMA, EggNOG
Dog491960CDX4caudal type homeobox 49615VGNC:39086Inparanoid, OMA, EggNOG
Horse100059663CDX4caudal type homeobox 49796VGNC:16378Inparanoid, OMA, EggNOG
Cow519648CDX4caudal type homeobox 49913VGNC:27159OMA, EggNOG
Pig100623433CDX4caudal type homeobox 49823OMA, EggNOG
Chicken395320CDX4caudal type homeobox 49031CGNC:49264Inparanoid, EggNOG
Xenopus395056cdx4caudal type homeobox 48364XB-GENE-482787Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein CDX-4
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein CDX-4
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein CDX-4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.