🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

COMT

BeschreibungCatechol O-methyltransferase

Gene and Protein Information

Gene ID1312
Uniprot Accession IDs P21964 A8MPV9 Q6IB07 Q6ICE6 Q9BWC7
Ensembl ID ENSP00000354511
Symbol HEL-S-98n
FamilyBelongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family.
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp458655COMTcatechol-O-methyltransferase9598VGNC:12831OMA, EggNOG
Mouse12846Comtcatechol-O-methyltransferase10090MGI:88470Inparanoid, OMA, EggNOG
Rat24267Comtcatechol-O-methyltransferase10116RGD:2379Inparanoid, OMA, EggNOG
Dog445450COMTcatechol-O-methyltransferase9615VGNC:39501Inparanoid, OMA, EggNOG
Pig100155530COMTcatechol-O-methyltransferase9823Inparanoid, OMA, EggNOG
Chicken416783MIR4761microRNA 47619031CGNC:1439OMA, EggNOG
Xenopus100135405LOC100135405uncharacterized LOC1001354058364Inparanoid, OMA
Xenopus549111comtcatechol-O-methyltransferase8364XB-GENE-948947OMA, EggNOG
Zebrafish561372comtacatechol-O-methyltransferase a7955ZDB-GENE-050913-117OMA, EggNOG
Zebrafish565370comtbcatechol-O-methyltransferase b7955ZDB-GENE-040724-164Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    methyltransferase    /    Catechol O-methyltransferase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Methyltransferase    /    Catechol O-methyltransferase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.