Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Vacuolar protein sorting-associated protein 4A |
|---|
Gene and Protein Information
| Gene ID | 27183 |
|---|---|
| Uniprot Accession IDs | Q9UN37 B2RCB7 Q8TF07 Q9UI03 Q9Y582 |
| Ensembl ID | ENSP00000254950 |
| Symbol | VPS4 SKD1 SKD2 VPS4 SKD1A VPS4-1 |
| Family | Belongs to the AAA ATPase family. |
| Sequence | MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743569 | VPS4A | vacuolar protein sorting 4 homolog A | 9598 | OMA, EggNOG | |
| Macaque | 705277 | VPS4A | vacuolar protein sorting 4 homolog A | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 116733 | Vps4a | vacuolar protein sorting 4A | 10090 | MGI:1890520 | Inparanoid, OMA, EggNOG |
| Rat | 246772 | Vps4a | vacuolar protein sorting 4 homolog A | 10116 | RGD:628810 | Inparanoid, OMA |
| Dog | 479674 | VPS4A | vacuolar protein sorting 4 homolog A | 9615 | Inparanoid, OMA | |
| Cow | 618168 | VPS4A | vacuolar protein sorting 4 homolog A | 9913 | Inparanoid, OMA | |
| Pig | 100627841 | VPS4A | vacuolar protein sorting 4 homolog A | 9823 | Inparanoid, OMA | |
| Xenopus | 100158600 | vps4a | vacuolar protein sorting 4 homolog A | 8364 | XB-GENE-970546 | Inparanoid, OMA |
| C. elegans | 189590 | vps-4 | related to yeast Vacuolar Protein Sorting factor | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856303 | VPS4 | AAA family ATPase VPS4 | 4932 | S000006377 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Vacuolar protein sorting-associated protein 4A
protein / cytoskeletal protein / non-motor microtubule binding protein / Vacuolar protein sorting-associated protein 4A
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Vacuolar protein sorting-associated protein 4A
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Vacuolar protein sorting-associated protein 4A
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.