🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

ZNHIT1

BeschreibungZinc finger HIT domain-containing protein 1

Gene and Protein Information

Gene ID10467
Uniprot Accession IDs O43257 Q6IB12
Ensembl ID ENSP00000304593
Symbol CGBP1 ZNFN4A1 CG1I ZNFN4A1
FamilyBelongs to the ZNHIT1 family.
Sequence
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp472469ZNHIT1zinc finger HIT-type containing 19598VGNC:4589OMA, EggNOG
Macaque714339ZNHIT1zinc finger HIT-type containing 19544Inparanoid, OMA, EggNOG
Mouse70103Znhit1zinc finger, HIT domain containing 110090MGI:1917353Inparanoid, OMA, EggNOG
Rat100360077Znhit1zinc finger, HIT-type containing 110116RGD:2322870Inparanoid, OMA, EggNOG
Dog479729ZNHIT1zinc finger HIT-type containing 19615VGNC:48835Inparanoid, OMA, EggNOG
Horse100059516ZNHIT1zinc finger HIT-type containing 19796VGNC:25399Inparanoid, OMA, EggNOG
Cow514997ZNHIT1zinc finger HIT-type containing 19913VGNC:37358Inparanoid, OMA, EggNOG
Opossum100016770ZNHIT1zinc finger HIT-type containing 113616Inparanoid, OMA, EggNOG
Xenopus549810znhit1zinc finger, HIT-type containing 18364XB-GENE-5848028Inparanoid, OMA, EggNOG
Zebrafish407699znhit1zinc finger, HIT-type containing 17955ZDB-GENE-050417-272Inparanoid, OMA, EggNOG
C. elegans183878zhit-1Zinc finger, HIT-type6239Inparanoid, OMA, EggNOG
Fruitfly326171CG31917CG31917 gene product from transcript CG31917-RA7227FBgn0031668Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    zinc finger transcription factor    /    Zinc finger HIT domain-containing protein 1
DTO Classes
protein    /    Transcription factor    /    Zinc finger transcription factor    /    Zinc finger HIT domain-containing protein 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.