🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

UNC119

BeschreibungProtein unc-119 homolog A

Gene and Protein Information

Gene ID9094
Uniprot Accession IDs Q13432 A8K8G4 F1T095 O95126
Ensembl ID ENSP00000337040
Symbol RG4 HRG4 POC7 IMD13 POC7A
FamilyBelongs to the PDE6D/unc-119 family.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp455028UNC119unc-119 lipid binding chaperone9598VGNC:9763OMA, EggNOG
Macaque716064UNC119unc-119 lipid binding chaperone9544OMA, EggNOG
Mouse22248Unc119unc-119 lipid binding chaperone10090MGI:1328357Inparanoid, OMA, EggNOG
Rat29402Unc119unc-119 lipid binding chaperone10116RGD:3942Inparanoid, OMA, EggNOG
Dog491169UNC119unc-119 lipid binding chaperone9615VGNC:48133Inparanoid, OMA, EggNOG
Horse100059151UNC119unc-119 lipid binding chaperone9796VGNC:24789Inparanoid, OMA, EggNOG
Cow538501UNC119unc-119 lipid binding chaperone9913VGNC:36662Inparanoid, OMA, EggNOG
PlatypusUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]9258OMA, EggNOG
Chicken771690UNC119unc-119 lipid binding chaperone9031CGNC:2670Inparanoid, OMA
Anole lizardUNC119unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565]28377Inparanoid, OMA, EggNOG
Xenopus100127819unc119unc-119 lipid binding chaperone8364XB-GENE-954877Inparanoid, OMA, EggNOG
Zebrafish678653unc119bunc-119 homolog b (C. elegans)7955ZDB-GENE-050201-2OMA, EggNOG
C. elegans176519unc-119Protein unc-1196239OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.