Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Voltage-dependent anion-selective channel protein 2 |
|---|
Gene and Protein Information
| Gene ID | 7417 |
|---|---|
| Uniprot Accession IDs | P45880 Q5VWK1 Q5VWK3 Q6IB40 Q7L3J5 Q9BWK8 Q9Y5I6 VDAC-2 |
| Ensembl ID | ENSP00000361635 |
| Symbol | POR |
| Family | Belongs to the eukaryotic mitochondrial porin family. |
| Sequence | MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471721 | LOC471721 | voltage-dependent anion-selective channel protein 2 | 9598 | OMA, EggNOG | |
| Macaque | 704257 | VDAC2 | voltage dependent anion channel 2 | 9544 | Inparanoid, OMA | |
| Mouse | 22334 | Vdac2 | voltage-dependent anion channel 2 | 10090 | MGI:106915 | Inparanoid, OMA, EggNOG |
| Rat | 83531 | Vdac2 | voltage-dependent anion channel 2 | 10116 | RGD:621576 | Inparanoid, OMA, EggNOG |
| Dog | 479255 | VDAC2 | voltage dependent anion channel 2 | 9615 | VGNC:48247 | Inparanoid, OMA, EggNOG |
| Horse | 100064276 | VDAC2 | voltage dependent anion channel 2 | 9796 | VGNC:24896 | Inparanoid, OMA, EggNOG |
| Cow | 282120 | VDAC2 | voltage dependent anion channel 2 | 9913 | VGNC:36783 | Inparanoid, OMA, EggNOG |
| Pig | 397659 | VDAC2 | voltage dependent anion channel 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012461 | VDAC2 | voltage dependent anion channel 2 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100075011 | VDAC2 | voltage dependent anion channel 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 395498 | VDAC2 | voltage dependent anion channel 2 | 9031 | CGNC:49348 | Inparanoid, OMA |
| Anole lizard | 100565441 | vdac2 | voltage dependent anion channel 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 548947 | vdac2 | voltage-dependent anion channel 2 | 8364 | XB-GENE-954839 | Inparanoid, OMA |
| Zebrafish | 322126 | vdac2 | voltage-dependent anion channel 2 | 7955 | ZDB-GENE-030131-845 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.