NUDT1

Beschreibung7,8-dihydro-8-oxoguanine triphosphatase

Gene and Protein Information

Gene ID4521
Uniprot Accession IDs P36639 A4D205 Q6LES7 Q6P0Y6 Q7Z7N6 Q8IV95 Q9UBM0 Q9UBM9
Ensembl ID ENSP00000380241
Symbol MTH1 MTH1
FamilyBelongs to the Nudix hydrolase family.
Sequence
MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp463225NUDT1nudix hydrolase 19598VGNC:4451OMA, EggNOG
Macaque713078NUDT1nudix hydrolase 19544Inparanoid, OMA, EggNOG
Mouse17766Nudt1nudix (nucleoside diphosphate linked moiety X)-type motif 110090MGI:109280Inparanoid, OMA, EggNOG
Rat117260Nudt1nudix hydrolase 110116RGD:621080Inparanoid, OMA, EggNOG
Dog489894NUDT1nudix hydrolase 19615VGNC:44024Inparanoid, OMA, EggNOG
Horse100059629NUDT1nudix hydrolase 19796VGNC:20940Inparanoid, OMA, EggNOG
Cow525496NUDT1nudix hydrolase 19913VGNC:32325Inparanoid, OMA, EggNOG
Opossum100029290NUDT1nudix hydrolase 113616Inparanoid, OMA, EggNOG
Chicken416467NUDT1nudix hydrolase 19031CGNC:3119Inparanoid, OMA
Anole lizard100564610nudt1nudix hydrolase 128377Inparanoid, OMA, EggNOG
Xenopus448146nudt1nudix hydrolase 18364XB-GENE-975736Inparanoid, OMA, EggNOG
Zebrafish406727nudt1nudix (nucleoside diphosphate linked moiety X)-type motif 17955ZDB-GENE-040426-2757Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    phosphorylase    /    7,8-dihydro-8-oxoguanine triphosphatase
protein    /    transferase    /    hydrolase    /    7,8-dihydro-8-oxoguanine triphosphatase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Phosphorylase    /    7,8-dihydro-8-oxoguanine triphosphatase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.