Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Transcription factor AP-2-alpha |
|---|
Gene and Protein Information
| Gene ID | 7020 |
|---|---|
| Uniprot Accession IDs | P05549 Q13777 Q5TAV5 Q8N1C6 AP2-alpha |
| Ensembl ID | ENSP00000368924 |
| Symbol | AP2TF TFAP2 AP-2 BOFS AP2TF TFAP2 AP-2alpha |
| Family | Belongs to the AP-2 family. |
| Sequence | MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 700663 | TFAP2A | transcription factor AP-2 alpha | 9544 | Inparanoid, OMA | |
| Mouse | 21418 | Tfap2a | transcription factor AP-2, alpha | 10090 | MGI:104671 | Inparanoid, OMA |
| Rat | 306862 | Tfap2a | transcription factor AP-2 alpha | 10116 | RGD:1310267 | Inparanoid, OMA |
| Dog | 488213 | TFAP2A | transcription factor AP-2 alpha | 9615 | VGNC:47283 | Inparanoid, OMA |
| Horse | 100063009 | TFAP2A | transcription factor AP-2 alpha | 9796 | VGNC:24028 | Inparanoid, OMA |
| Cow | 505849 | TFAP2A | transcription factor AP-2 alpha | 9913 | VGNC:35776 | Inparanoid, OMA |
| Pig | 100049668 | TFAP2A | transcription factor AP-2 alpha | 9823 | Inparanoid, OMA | |
| Opossum | 100019883 | TFAP2A | transcription factor AP-2 alpha | 13616 | Inparanoid, OMA | |
| Platypus | 100082770 | TFAP2A | transcription factor AP-2 alpha | 9258 | Inparanoid, OMA | |
| Xenopus | 395064 | tfap2a | tto transcription factor AP-2 alpha | 8364 | XB-GENE-481201 | Inparanoid, OMA |
| Zebrafish | 140618 | tfap2a | transcription factor AP-2 alpha | 7955 | ZDB-GENE-011212-6 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.