🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

ELOVL6

BeschreibungElongation of very long chain fatty acids protein 6

Gene and Protein Information

Gene ID79071
Uniprot Accession IDs Q9H5J4 Q4W5L0 Q8NCD1
Ensembl ID ENSP00000378105
Symbol FACE LCE FAE LCE FACE
FamilyBelongs to the ELO family. ELOVL6 subfamily.
Sequence
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp461436ELOVL6ELOVL fatty acid elongase 69598VGNC:596OMA, EggNOG
Mouse170439Elovl6ELOVL family member 6, elongation of long chain fatty acids (yeast)10090MGI:2156528Inparanoid, OMA, EggNOG
Rat171402Elovl6ELOVL fatty acid elongase 610116RGD:620585Inparanoid, EggNOG
Dog487900ELOVL6ELOVL fatty acid elongase 69615VGNC:40324Inparanoid, OMA, EggNOG
Horse100072829ELOVL6ELOVL fatty acid elongase 69796VGNC:17542Inparanoid, OMA, EggNOG
Cow533333ELOVL6ELOVL fatty acid elongase 69913VGNC:28452OMA, EggNOG
Opossum100020799ELOVL6ELOVL fatty acid elongase 613616OMA, EggNOG
Chicken428772ELOVL6ELOVL fatty acid elongase 69031CGNC:53457Inparanoid, OMA, EggNOG
Anole lizard100555143elovl6ELOVL fatty acid elongase 628377Inparanoid, OMA, EggNOG
Xenopus550011elovl6ELOVL fatty acid elongase 68364XB-GENE-942876Inparanoid, OMA, EggNOG
Zebrafish317738elovl6ELOVL fatty acid elongase 67955ZDB-GENE-030114-1Inparanoid, OMA, EggNOG
Fruitfly39860BaldspotCG3971 gene product from transcript CG3971-RA7227FBgn0260960Inparanoid, EggNOG
S.cerevisiae853243ELO1fatty acid elongase ELO14932S000003732OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Elongation of very long chain fatty acids protein 6
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Elongation of very long chain fatty acids protein 6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.