Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Adenosine receptor A2b |
|---|
Gene and Protein Information
| Gene ID | 136 |
|---|---|
| Uniprot Accession IDs | P29275 |
| Ensembl ID | ENSP00000304501 |
| Symbol | ADORA2 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455009 | ADORA2B | adenosine A2b receptor | 9598 | VGNC:9120 | OMA, EggNOG |
| Mouse | 11541 | Adora2b | adenosine A2b receptor | 10090 | MGI:99403 | Inparanoid, OMA, EggNOG |
| Rat | 29316 | Adora2b | adenosine A2B receptor | 10116 | RGD:2050 | Inparanoid, OMA, EggNOG |
| Dog | 403410 | ADORA2B | adenosine A2b receptor | 9615 | VGNC:37667 | Inparanoid, OMA, EggNOG |
| Horse | 100063319 | ADORA2B | adenosine A2b receptor | 9796 | VGNC:15127 | Inparanoid, OMA, EggNOG |
| Cow | 529760 | ADORA2B | adenosine A2b receptor | 9913 | VGNC:25688 | Inparanoid, OMA, EggNOG |
| Opossum | ADORA2B | adenosine A2b receptor [Source:HGNC Symbol;Acc:HGNC:264] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 395971 | ADORA2B | adenosine A2b receptor | 9031 | CGNC:49582 | Inparanoid, OMA |
| Zebrafish | 560100 | adora2b | adenosine A2b receptor | 7955 | ZDB-GENE-060511-1 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a2b
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a2b
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.