🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

GJB4

BeschreibungGap junction beta-4 protein

Gene and Protein Information

Gene ID127534
Uniprot Accession IDs Q9NTQ9 B3KQ82
Ensembl ID ENSP00000345868
Symbol EKV EKVP2 CX30.3
FamilyBelongs to the connexin family. Beta-type (group I) subfamily.
Sequence
MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp469272GJB4gap junction protein beta 49598VGNC:11439OMA, EggNOG
Macaque710994GJB4gap junction protein beta 49544Inparanoid, OMA, EggNOG
Mouse14621Gjb4gap junction protein, beta 410090MGI:95722Inparanoid, OMA, EggNOG
Rat117055Gjb4gap junction protein, beta 410116RGD:621829Inparanoid, OMA, EggNOG
Dog482487GJB4gap junction protein beta 49615VGNC:41240Inparanoid, OMA, EggNOG
Horse100069762GJB4gap junction protein beta 49796VGNC:18357Inparanoid, OMA, EggNOG
Cow100140553GJB4gap junction protein beta 49913VGNC:29379Inparanoid, OMA, EggNOG
Opossum100031157GJB4gap junction protein beta 413616Inparanoid, OMA, EggNOG
Platypus100076681GJB4gap junction protein beta 49258Inparanoid, OMA, EggNOG
Zebrafish404727cx34.4connexin 34.47955ZDB-GENE-040406-3Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction beta-4 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction beta-4 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.