Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | 5'-AMP-activated protein kinase subunit beta-1 |
|---|
Gene and Protein Information
| Gene ID | 5564 |
|---|---|
| Uniprot Accession IDs | Q9Y478 Q9UBV0 Q9UE20 Q9UEX2 Q9Y6V8 AMPK subunit beta-1 |
| Ensembl ID | ENSP00000229328 |
| Symbol | AMPK AMPK HAMPKb |
| Family | Belongs to the 5'-AMP-activated protein kinase beta subunit family. |
| Sequence | MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452297 | PRKAB1 | protein kinase AMP-activated non-catalytic subunit beta 1 | 9598 | VGNC:8503 | OMA, EggNOG |
| Macaque | 695737 | PRKAB1 | protein kinase AMP-activated non-catalytic subunit beta 1 | 9544 | OMA, EggNOG | |
| Mouse | 19079 | Prkab1 | protein kinase, AMP-activated, beta 1 non-catalytic subunit | 10090 | MGI:1336167 | OMA, EggNOG |
| Rat | 83803 | Prkab1 | protein kinase AMP-activated non-catalytic subunit beta 1 | 10116 | RGD:71057 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase modulator / 5'-AMP-activated protein kinase subunit beta-1
protein / enzyme modulator / kinase modulator / 5'-AMP-activated protein kinase subunit beta-1
DTO Classes
protein / Kinase / Protein kinase / CAMK group / CAMKL family / 5'-AMP-activated protein kinase subunit beta-1
protein / Kinase / Protein kinase / CAMK group / CAMKL family / 5'-AMP-activated protein kinase subunit beta-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.