🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Eukaryotic translation initiation factor 4E-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 1978 |
|---|---|
| Uniprot Accession IDs | Q13541 B2R502 D3DSW8 Q6IBN3 4E-BP1 |
| Ensembl ID | ENSP00000340691 |
| Symbol | BP-1 4EBP1 4E-BP1 PHAS-I |
| Family | Belongs to the eIF4E-binding protein family. |
| Sequence | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464114 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9598 | VGNC:884 | OMA, EggNOG |
| Macaque | 703628 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9544 | Inparanoid, EggNOG | |
| Mouse | 13685 | Eif4ebp1 | eukaryotic translation initiation factor 4E binding protein 1 | 10090 | MGI:103267 | Inparanoid, OMA, EggNOG |
| Rat | 116636 | Eif4ebp1 | eukaryotic translation initiation factor 4E binding protein 1 | 10116 | RGD:620259 | Inparanoid, OMA, EggNOG |
| Dog | 475590 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9615 | VGNC:40286 | Inparanoid, OMA, EggNOG |
| Horse | 100057875 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9796 | VGNC:17505 | Inparanoid, OMA, EggNOG |
| Cow | 509613 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9913 | VGNC:28412 | Inparanoid, OMA, EggNOG |
| Pig | 100627508 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100029774 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 426773 | EIF4EBP1 | eukaryotic translation initiation factor 4E binding protein 1 | 9031 | CGNC:2329 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation factor / Eukaryotic translation initiation factor 4E-binding protein 1
protein / nucleic acid binding / translation factor / Eukaryotic translation initiation factor 4E-binding protein 1
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Eukaryotic translation initiation factor 4E-binding protein 1
protein / Nucleic acid binding / RNA binding protein / Translation factor / Eukaryotic translation initiation factor 4E-binding protein 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.