Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Adhesion G-protein coupled receptor G1 |
|---|
Gene and Protein Information
| Gene ID | 9289 |
|---|---|
| Uniprot Accession IDs | Q9Y653 A6NIT7 A6NJV9 B0M0K4 B4DR54 O95966 Q6ZMP1 Q8NGB3 Q96HB4 |
| Ensembl ID | ENSP00000455215 |
| Symbol | GPR56 TM7LN4 TM7XN1 BFPP BPPR GPR56 TM7LN4 TM7XN1 |
| Family | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. |
| Sequence | MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 613233 | ADGRG1 | adhesion G protein-coupled receptor G1 | 9544 | Inparanoid, OMA | |
| Mouse | 14766 | Adgrg1 | adhesion G protein-coupled receptor G1 | 10090 | MGI:1340051 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / antibacterial response protein / G-protein coupled receptor 56
protein / receptor / G-protein coupled receptor / G-protein coupled receptor 56
protein / receptor / protease / G-protein coupled receptor 56
protein / receptor / antibacterial response protein / G-protein coupled receptor 56
protein / receptor / G-protein coupled receptor / G-protein coupled receptor 56
protein / receptor / protease / G-protein coupled receptor 56
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.