🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

NPPC

BeschreibungC-type natriuretic peptide

Gene and Protein Information

Gene ID4880
Uniprot Accession IDs P23582 Q4ZG41
Ensembl ID ENSP00000387159
Symbol CNP2 CNP CNP2
FamilyBelongs to the natriuretic peptide family.
Sequence
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp740147NPPCnatriuretic peptide C9598VGNC:14324OMA, EggNOG
Macaque717026NPPCnatriuretic peptide C9544Inparanoid, OMA, EggNOG
Mouse18159Nppcnatriuretic peptide type C10090MGI:97369Inparanoid, OMA, EggNOG
Rat114593Nppcnatriuretic peptide C10116RGD:620850Inparanoid, OMA, EggNOG
Dog610169NPPCnatriuretic peptide C9615VGNC:43927Inparanoid, OMA, EggNOG
HorseNPPCnatriuretic peptide C [Source:HGNC Symbol;Acc:HGNC:7941]9796OMA, EggNOG
Cow281356NPPCnatriuretic peptide C9913VGNC:32212Inparanoid, OMA, EggNOG
Pig493772NPPCnatriuretic peptide C9823Inparanoid, OMA, EggNOG
Opossum100011305NPPCnatriuretic peptide C13616Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    C-type natriuretic peptide
DTO Classes
protein    /    Signaling    /    Hormone    /    C-type natriuretic peptide

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.