🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

ANGPT2

BeschreibungAngiopoietin-2

Gene and Protein Information

Gene ID285
Uniprot Accession IDs O15123 A0AV38 A8K205 B7ZLM7 Q9NRR7 Q9P2Y7 ANG-2
Ensembl ID ENSP00000314897
Symbol ANG2 AGPT2
Sequence
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp742508ANGPT2angiopoietin 29598VGNC:921OMA, EggNOG
Macaque716811ANGPT2angiopoietin 29544Inparanoid, OMA, EggNOG
Mouse11601Angpt2angiopoietin 210090MGI:1202890Inparanoid, OMA, EggNOG
Rat89805Angpt2angiopoietin 210116RGD:621861Inparanoid, OMA, EggNOG
Dog607616ANGPT2angiopoietin 29615VGNC:37855Inparanoid, OMA, EggNOG
Horse100051890ANGPT2angiopoietin 29796VGNC:15299Inparanoid, OMA, EggNOG
Cow282141ANGPT2angiopoietin 29913VGNC:25888Inparanoid, OMA, EggNOG
Pig396730ANGPT2angiopoietin 29823Inparanoid, OMA
Opossum100028850ANGPT2angiopoietin 213616Inparanoid, EggNOG
Platypus100073414ANGPT2angiopoietin 29258Inparanoid, OMA, EggNOG
Anole lizard100554406angpt2angiopoietin 228377Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.