🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Protein C-ets-1 |
|---|
Gene and Protein Information
| Gene ID | 2113 |
|---|---|
| Uniprot Accession IDs | P14921 A9UL17 F5GYX9 Q14278 Q16080 Q6N087 Q96AC5 |
| Ensembl ID | ENSP00000376436 |
| Symbol | EWSR2 p54 ETS-1 EWSR2 c-ets-1 |
| Family | Belongs to the ETS family. |
| Sequence | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451695 | ETS1 | ETS proto-oncogene 1, transcription factor | 9598 | VGNC:8163 | OMA, EggNOG |
| Macaque | 714697 | ETS1 | ETS proto-oncogene 1, transcription factor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 23871 | Ets1 | E26 avian leukemia oncogene 1, 5' domain | 10090 | MGI:95455 | Inparanoid, OMA, EggNOG |
| Rat | 24356 | Ets1 | ETS proto-oncogene 1, transcription factor | 10116 | RGD:2583 | Inparanoid, OMA |
| Dog | 489287 | ETS1 | ETS proto-oncogene 1, transcription factor | 9615 | VGNC:40494 | Inparanoid, OMA, EggNOG |
| Horse | 100064559 | ETS1 | ETS proto-oncogene 1, transcription factor | 9796 | VGNC:17700 | Inparanoid, OMA, EggNOG |
| Cow | 540313 | ETS1 | ETS proto-oncogene 1, transcription factor | 9913 | VGNC:28626 | Inparanoid, OMA, EggNOG |
| Pig | 100302363 | ETS1 | ETS proto-oncogene 1, transcription factor | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100016808 | ETS1 | ETS proto-oncogene 1, transcription factor | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 396235 | ETS1 | v-ets avian erythroblastosis virus E26 oncogene homolog 1 | 9031 | CGNC:3319 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556201 | ets1 | ETS proto-oncogene 1, transcription factor | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100170599 | ets1 | v-ets avian erythroblastosis virus E26 oncogene homolog 1 | 8364 | XB-GENE-6465484 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.