🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

SERPINA1

BeschreibungAlpha-1-antitrypsin

Gene and Protein Information

Gene ID5265
Uniprot Accession IDs P01009 A6PX14 B2RDQ8 Q0PVP5 Q13672 Q53XB8 Q5U0M1 Q7M4R2 Q86U18 Q86U19 Q96BF9 Q96ES1 Q9P1P0 Q9UCE6 Q9UCM3
Ensembl ID ENSP00000416066
Symbol AAT PI PI A1A AAT PI1 A1AT nNIF PRO2275 alpha1AT
FamilyBelongs to the serpin family.
Sequence
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp467541SERPINA1serpin family A member 19598OMA, EggNOG
Macaque701361SERPINA1serpin family A member 19544Inparanoid, OMA, EggNOG
Mouse20704Serpina1eserine (or cysteine) peptidase inhibitor, clade A, member 1E10090MGI:891967Inparanoid, OMA
Mouse20702Serpina1cserine (or cysteine) peptidase inhibitor, clade A, member 1C10090MGI:891969OMA, EggNOG
Rat24648Serpina1serpin family A member 110116RGD:3326Inparanoid, OMA, EggNOG
Dog480422SERPINA1serpin family A member 19615VGNC:51681Inparanoid, OMA, EggNOG
Horse100065191LOC100065191alpha-1-antiproteinase 2-like9796Inparanoid, OMA
Horse100065068LOC100065068alpha-1-antiproteinase 2-like9796OMA, EggNOG
Cow280699SERPINA1serpin family A member 19913VGNC:53953Inparanoid, OMA, EggNOG
Pig397688SERPINA1serpin family A member 19823Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Alpha-1-antitrypsin
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Alpha-1-antitrypsin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.