🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | 5-hydroxytryptamine receptor 2C |
|---|
Gene and Protein Information
| Gene ID | 3358 |
|---|---|
| Uniprot Accession IDs | P28335 B1AMW4 Q5VUF8 Q9NP28 5-HT-2C |
| Ensembl ID | ENSP00000276198 |
| Symbol | HTR1C HTR1C 5-HT1C 5-HT2C 5HTR2C 5-HTR2C |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473740 | HTR2C | 5-hydroxytryptamine receptor 2C | 9598 | VGNC:7460 | Inparanoid, OMA, EggNOG |
| Macaque | 708141 | HTR2C | 5-hydroxytryptamine receptor 2C | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15560 | Htr2c | 5-hydroxytryptamine (serotonin) receptor 2C | 10090 | MGI:96281 | Inparanoid, OMA, EggNOG |
| Rat | 25187 | Htr2c | 5-hydroxytryptamine receptor 2C | 10116 | RGD:2848 | Inparanoid, OMA, EggNOG |
| Dog | 450240 | HTR2C | 5-hydroxytryptamine receptor 2C | 9615 | VGNC:41828 | Inparanoid, OMA, EggNOG |
| Horse | 100057852 | HTR2C | 5-hydroxytryptamine receptor 2C | 9796 | VGNC:18905 | Inparanoid, OMA, EggNOG |
| Pig | 100524920 | HTR2C | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011052 | HTR2C | 5-hydroxytryptamine receptor 2C | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100496012 | htr2c | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 8364 | XB-GENE-967634 | Inparanoid, OMA |
| Zebrafish | 100000981 | htr2cl1 | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 | 7955 | ZDB-GENE-081104-48 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT2 receptor / 5-hydroxytryptamine receptor 2c
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT2 receptor / 5-hydroxytryptamine receptor 2c
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.