HTR2C

Beschreibung5-hydroxytryptamine receptor 2C

Gene and Protein Information

Gene ID3358
Uniprot Accession IDs P28335 B1AMW4 Q5VUF8 Q9NP28 5-HT-2C
Ensembl ID ENSP00000276198
Symbol HTR1C HTR1C 5-HT1C 5-HT2C 5HTR2C 5-HTR2C
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp473740HTR2C5-hydroxytryptamine receptor 2C9598VGNC:7460Inparanoid, OMA, EggNOG
Macaque708141HTR2C5-hydroxytryptamine receptor 2C9544Inparanoid, OMA, EggNOG
Mouse15560Htr2c5-hydroxytryptamine (serotonin) receptor 2C10090MGI:96281Inparanoid, OMA, EggNOG
Rat25187Htr2c5-hydroxytryptamine receptor 2C10116RGD:2848Inparanoid, OMA, EggNOG
Dog450240HTR2C5-hydroxytryptamine receptor 2C9615VGNC:41828Inparanoid, OMA, EggNOG
Horse100057852HTR2C5-hydroxytryptamine receptor 2C9796VGNC:18905Inparanoid, OMA, EggNOG
Pig100524920HTR2C5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled9823Inparanoid, OMA, EggNOG
Opossum100011052HTR2C5-hydroxytryptamine receptor 2C13616Inparanoid, OMA, EggNOG
Xenopus100496012htr2c5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled8364XB-GENE-967634Inparanoid, OMA
Zebrafish100000981htr2cl15-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 17955ZDB-GENE-081104-48Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 2c
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT2 receptor    /    5-hydroxytryptamine receptor 2c

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.