🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

TAS2R16

BeschreibungTaste receptor type 2 member 16

Gene and Protein Information

Gene ID50833
Uniprot Accession IDs Q9NYV7 A4D0X2 Q502V3 Q549U8 Q645W1 T2R16
Ensembl ID ENSP00000249284
Symbol BGLPT T2R16
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp494113TAS2R16taste 2 receptor member 169598VGNC:8769Inparanoid, OMA, EggNOG
Mouse387347Tas2r118taste receptor, type 2, member 11810090MGI:2681247Inparanoid, OMA, EggNOG
Rat78980Tas2r118taste receptor, type 2, member 11810116RGD:620735Inparanoid, OMA, EggNOG
Cow664638TAS2R16taste 2 receptor member 169913VGNC:35610Inparanoid, OMA
Opossum664658T2R62bitter taste receptor Modo-T2R6213616Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 16

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.