🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

UHMK1

BeschreibungSerine/threonine-protein kinase Kist

Gene and Protein Information

Gene ID127933
Uniprot Accession IDs Q8TAS1 A0A0A6YYC2 A8K8K4 G3V1M1 Q96C22
Ensembl ID ENSP00000420270
Symbol KIS KIST KIS KIST P-CIP2
FamilyBelongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Sequence
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp469560UHMK1U2AF homology motif kinase 19598VGNC:14299OMA, EggNOG
Macaque720105UHMK1U2AF homology motif kinase 19544Inparanoid, OMA, EggNOG
Mouse16589Uhmk1U2AF homology motif (UHM) kinase 110090MGI:1341908Inparanoid, OMA, EggNOG
Rat246332Uhmk1U2AF homology motif kinase 110116RGD:2968Inparanoid, OMA
Dog478986UHMK1U2AF homology motif kinase 19615VGNC:48122Inparanoid, OMA, EggNOG
Horse100058796UHMK1U2AF homology motif kinase 19796VGNC:24780Inparanoid, OMA, EggNOG
Cow538770UHMK1U2AF homology motif kinase 19913VGNC:36653Inparanoid, OMA, EggNOG
Opossum100012274UHMK1U2AF homology motif kinase 113616OMA, EggNOG
Chicken424369UHMK1U2AF homology motif kinase 19031CGNC:1973Inparanoid, OMA, EggNOG
Zebrafish767721uhmk1U2AF homology motif (UHM) kinase 17955ZDB-GENE-060929-1014Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    Other group    /    KIS family    /    Serine/threonine-protein kinase kist

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.