Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Activated RNA polymerase II transcriptional coactivator p15 |
|---|
Gene and Protein Information
| Gene ID | 10923 |
|---|---|
| Uniprot Accession IDs | P53999 Q96L29 |
| Ensembl ID | ENSP00000265073 |
| Symbol | PC4 RPO2TC1 P15 PC4 p14 |
| Family | Belongs to the transcriptional coactivator PC4 family. |
| Sequence | MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 20024 | Sub1 | SUB1 homolog (S. cerevisiae) | 10090 | MGI:104811 | Inparanoid, OMA, EggNOG |
| Rat | 192269 | Sub1 | SUB1 homolog, transcriptional regulator | 10116 | RGD:621582 | Inparanoid, OMA, EggNOG |
| Dog | 479283 | SUB1 | SUB1 homolog, transcriptional regulator | 9615 | OMA, EggNOG | |
| Horse | 100068496 | SUB1 | SUB1 homolog, transcriptional regulator | 9796 | VGNC:23741 | Inparanoid, OMA, EggNOG |
| Cow | 533984 | SUB1 | SUB1 homolog, transcriptional regulator | 9913 | VGNC:35454 | Inparanoid, OMA, EggNOG |
| Opossum | 100015659 | SUB1 | SUB1 homolog, transcriptional regulator | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100092955 | SUB1 | SUB1 homolog, transcriptional regulator | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 427425 | SUB1 | SUB1 homolog, transcriptional regulator | 9031 | CGNC:2359 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563239 | sub1 | SUB1 homolog, transcriptional regulator | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448190 | sub1 | SUB1 homolog, transcriptional regulator | 8364 | XB-GENE-1015843 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553561 | sub1a | SUB1 homolog, transcriptional regulator a | 7955 | ZDB-GENE-050522-151 | Inparanoid, OMA |
| C. elegans | 188475 | T13F2.2 | Putative RNA polymerase II transcriptional coactivator | 6239 | Inparanoid, OMA | |
| Fruitfly | 34120 | Ssb-c31a | Single stranded-binding protein c31A | 7227 | FBgn0015299 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.