🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CD207

BeschreibungC-type lectin domain family 4 member K

Gene and Protein Information

Gene ID50489
Uniprot Accession IDs Q9UJ71
Ensembl ID ENSP00000386378
Symbol CLEC4K CLEC4K
Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp737419CD207CD207 molecule9598VGNC:187OMA, EggNOG
Macaque703420CD207CD207 molecule9544Inparanoid, OMA, EggNOG
Mouse246278Cd207CD207 antigen10090MGI:2180021Inparanoid, OMA, EggNOG
Rat502852Cd207CD207 molecule10116RGD:1565913Inparanoid, OMA, EggNOG
Dog612679CD207CD207 molecule9615VGNC:54285Inparanoid, OMA, EggNOG
Horse100060253CD207CD207 molecule9796VGNC:16251Inparanoid, OMA, EggNOG
Cow511000CD207CD207 molecule9913VGNC:27011Inparanoid, OMA
Pig100037935CD207CD207 molecule9823Inparanoid, OMA, EggNOG
Opossum100025785CD207CD207 molecule13616Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    cell adhesion molecule    /    C-type lectin domain family 4 member K
protein    /    receptor    /    immunoglobulin receptor superfamily    /    C-type lectin domain family 4 member K
protein    /    receptor    /    defense/immunity protein    /    C-type lectin domain family 4 member K
protein    /    receptor    /    cytokine receptor    /    C-type lectin domain family 4 member K
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    C-type lectin domain family 4 member K

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.