🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

ATG13

BeschreibungAutophagy-related protein 13

Gene and Protein Information

Gene ID9776
Uniprot Accession IDs O75143 B4DFI4 D3DQQ1 D3DQQ2 E9PQZ8 Q53EN6 Q9BRL3 Q9H8B0
Ensembl ID ENSP00000432412
Symbol KIAA0652 KIAA0652 PARATARG8
FamilyBelongs to the ATG13 family. Metazoan subfamily.
Sequence
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp451155ATG13autophagy related 139598VGNC:3206Inparanoid, OMA, EggNOG
Macaque714322ATG13autophagy related 139544Inparanoid, OMA
Mouse51897Atg13autophagy related 1310090MGI:1196429Inparanoid, OMA, EggNOG
Rat362164Atg13autophagy related 1310116RGD:1310685Inparanoid, OMA
Dog483632ATG13autophagy related 139615VGNC:38217Inparanoid, OMA, EggNOG
Horse100050734ATG13autophagy related 139796VGNC:15618Inparanoid, OMA, EggNOG
Cow507340ATG13autophagy related 139913VGNC:26251Inparanoid, OMA, EggNOG
Pig100516128ATG13autophagy related 139823Inparanoid, OMA, EggNOG
Opossum100011759ATG13autophagy related 1313616Inparanoid, OMA, EggNOG
Chicken423192ATG13autophagy related 139031CGNC:6324Inparanoid, OMA, EggNOG
Anole lizard100566276atg13autophagy related 1328377Inparanoid, OMA, EggNOG
Xenopus100125026atg13autophagy related 138364XB-GENE-960599Inparanoid, OMA, EggNOG
Zebrafish393405atg13ATG13 autophagy related 13 homolog (S. cerevisiae)7955ZDB-GENE-040426-1149Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.