🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

CIRBP

BeschreibungCold-inducible RNA-binding protein

Gene and Protein Information

Gene ID1153
Uniprot Accession IDs Q14011 B3KT17 B4E2X2
Ensembl ID ENSP00000466897
Symbol A18HNRNP CIRP CIRP
Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque706175CIRBPcold inducible RNA binding protein9544Inparanoid, OMA, EggNOG
Mouse12696Cirbpcold inducible RNA binding protein10090MGI:893588Inparanoid, OMA, EggNOG
Rat81825Cirbpcold inducible RNA binding protein10116RGD:620756Inparanoid, OMA, EggNOG
Dog476755CIRBPcold inducible RNA binding protein9615VGNC:54590Inparanoid, OMA, EggNOG
Cow507120CIRBPcold inducible RNA binding protein9913VGNC:52752Inparanoid, OMA, EggNOG
Pig100522851CIRBPcold inducible RNA binding protein9823Inparanoid, OMA, EggNOG
OpossumCIRBPcold inducible RNA binding protein [Source:HGNC Symbol;Acc:HGNC:1982]13616Inparanoid, OMA, EggNOG
Platypus100087691LOC100087691cold-inducible RNA-binding protein9258OMA, EggNOG
Anole lizard100552626cirbpcold inducible RNA binding protein28377Inparanoid, OMA, EggNOG
Xenopus549982cirbpcold inducible RNA binding protein8364XB-GENE-492781Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Cold-inducible RNA-binding protein
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Cold-inducible RNA-binding protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.