The store will not work correctly when cookies are disabled.
JavaScript scheint in Ihrem Browser deaktiviert zu sein. Um unsere Website in bester Weise zu erfahren, aktivieren Sie Javascript in Ihrem Browser.
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
CISD1 Beschreibung CDGSH iron-sulfur domain-containing protein 1
Gene and Protein Information Gene ID 55847 Uniprot Accession IDs Q9NZ45 Q1X902 Ensembl ID ENSP00000363041 Symbol C10orf70 ZCD1 ZCD1 MDS029 C10orf70 mitoNEET Family Belongs to the CISD protein family. Sequence MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Steuer-ID Other Gene ID Sources Chimp 748227 CISD1 CDGSH iron sulfur domain 1 9598 VGNC:51970 OMA, EggNOG Macaque 701716 CISD1 CDGSH iron sulfur domain 1 9544 Inparanoid, OMA, EggNOG Mouse 52637 Cisd1 CDGSH iron sulfur domain 1 10090 MGI:1261855 Inparanoid, OMA, EggNOG Rat 294362 Cisd1 CDGSH iron sulfur domain 1 10116 RGD:1309529 Inparanoid, OMA, EggNOG Horse 100072162 CISD1 CDGSH iron sulfur domain 1 9796 OMA, EggNOG Cow 531444 CISD1 CDGSH iron sulfur domain 1 9913 VGNC:27371 Inparanoid, OMA, EggNOG Pig 100520401 LOC100520401 CDGSH iron-sulfur domain-containing protein 1 9823 Inparanoid, OMA, EggNOG Opossum 100024488 CISD1 CDGSH iron sulfur domain 1 13616 Inparanoid, EggNOG Platypus CISD1 CDGSH iron sulfur domain 1 [Source:HGNC Symbol;Acc:HGNC:30880] 9258 OMA, EggNOG Chicken 423642 CISD1 CDGSH iron sulfur domain 1 9031 CGNC:1950 Inparanoid, OMA, EggNOG Anole lizard 100559354 cisd1 CDGSH iron sulfur domain 1 28377 Inparanoid, OMA, EggNOG Xenopus 448057 cisd1 CDGSH iron sulfur domain 1 8364 XB-GENE-973366 Inparanoid, OMA, EggNOG Zebrafish 393577 cisd1 CDGSH iron sulfur domain 1 7955 ZDB-GENE-040426-1162 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Verfügbarkeit Details anzeigen
Associated Antibodies
Name Specifications Species reactivity Anwendung Verfügbarkeit Details anzeigen
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer
Cookie-Richtlinie. Einstellungen Alle zustimmen Ablehnen
Shall we send you a message when we have discounts available?
Remind me later Erlauben
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.