🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Actin-related protein 3 |
|---|
Gene and Protein Information
| Gene ID | 10096 |
|---|---|
| Uniprot Accession IDs | P61158 P32391 Q53QM2 |
| Ensembl ID | ENSP00000263238 |
| Symbol | ARP3 ARP3 |
| Family | Belongs to the actin family. ARP3 subfamily. |
| Sequence | MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 709836 | ACTR3 | ARP3 actin related protein 3 homolog | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 74117 | Actr3 | ARP3 actin-related protein 3 | 10090 | MGI:1921367 | Inparanoid, OMA, EggNOG |
| Rat | 81732 | Actr3 | ARP3 actin related protein 3 homolog | 10116 | RGD:71024 | Inparanoid, OMA, EggNOG |
| Dog | 475549 | ACTR3B | ARP3 actin related protein 3 homolog B | 9615 | VGNC:49707 | Inparanoid, EggNOG |
| Horse | 100033909 | ACTR3 | ARP3 actin related protein 3 homolog | 9796 | VGNC:49331 | Inparanoid, OMA |
| Cow | 281597 | ACTR3 | ARP3 actin related protein 3 homolog | 9913 | VGNC:50033 | Inparanoid, OMA |
| Pig | 396738 | ACTR3 | ARP3 actin related protein 3 homolog | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | ACTR3 | ARP3 actin related protein 3 homolog [Source:HGNC Symbol;Acc:HGNC:170] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 374197 | ACTR3 | ARP3 actin related protein 3 homolog | 9031 | CGNC:49080 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559108 | actr3 | ARP3 actin related protein 3 homolog | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394999 | actr3 | ARP3 actin-related protein 3 homolog | 8364 | XB-GENE-5915063 | OMA, EggNOG |
| C. elegans | 171857 | arx-1 | Actin-related protein 3 | 6239 | OMA, EggNOG | |
| Fruitfly | 38898 | Arp3 | Actin-related protein 3 | 7227 | FBgn0262716 | OMA, EggNOG |
| S.cerevisiae | 853528 | ARP3 | actin-related protein 3 | 4932 | S000003826 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / actin and actin related protein / Actin-related protein 3
protein / cytoskeletal protein / actin and actin related protein / Actin-related protein 3
DTO Classes
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Actin-related protein 3
protein / Cellular structure / Actin family cytoskeletal protein / Actin and actin related protein / Actin-related protein 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.