Toggle Nav 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Actin-related protein 2/3 complex subunit 2 |
|---|
Gene and Protein Information
| Gene ID | 10109 |
|---|---|
| Uniprot Accession IDs | O15144 Q92801 Q9P1D4 |
| Ensembl ID | ENSP00000295685 |
| Symbol | ARC34 ARC34 PRO2446 p34-Arc PNAS-139 |
| Family | Belongs to the ARPC2 family. |
| Sequence | MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459938 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9598 | VGNC:90 | OMA, EggNOG |
| Macaque | 700536 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 76709 | Arpc2 | actin related protein 2/3 complex, subunit 2 | 10090 | MGI:1923959 | Inparanoid, OMA, EggNOG |
| Rat | 301511 | Arpc2 | actin related protein 2/3 complex, subunit 2 | 10116 | RGD:1305848 | Inparanoid, OMA |
| Horse | 100058331 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9796 | VGNC:15537 | Inparanoid, OMA, EggNOG |
| Cow | 540838 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100153175 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011642 | ARPC2 | actin related protein 2/3 complex subunit 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 429041 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9031 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566658 | arpc2 | actin related protein 2/3 complex subunit 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448094 | arpc2 | actin related protein 2/3 complex subunit 2 | 8364 | XB-GENE-491571 | Inparanoid, OMA, EggNOG |
| Zebrafish | 327068 | arpc2 | actin related protein 2/3 complex, subunit 2 | 7955 | ZDB-GENE-030131-5276 | Inparanoid, OMA, EggNOG |
| C. elegans | 175247 | arx-4 | Probable actin-related protein 2/3 complex subunit 2 | 6239 | Inparanoid, OMA | |
| Fruitfly | 35311 | Arpc2 | Actin-related protein 2/3 complex, subunit 2 | 7227 | FBgn0032859 | Inparanoid, EggNOG |
| S.cerevisiae | 855771 | ARC35 | Arc35p | 4932 | S000005318 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.