Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Carbohydrate sulfotransferase 3 |
|---|
Gene and Protein Information
| Gene ID | 9469 |
|---|---|
| Uniprot Accession IDs | Q7LGC8 O75099 Q52M30 |
| Ensembl ID | ENSP00000362207 |
| Symbol | HSD C6ST C6ST1 |
| Family | Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily. |
| Sequence | MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466290 | CHST3 | carbohydrate sulfotransferase 3 | 9598 | VGNC:12282 | OMA, EggNOG |
| Mouse | 53374 | Chst3 | carbohydrate (chondroitin 6/keratan) sulfotransferase 3 | 10090 | MGI:1858224 | Inparanoid, OMA, EggNOG |
| Rat | 84468 | Chst3 | carbohydrate sulfotransferase 3 | 10116 | RGD:620355 | Inparanoid, OMA, EggNOG |
| Dog | 100855759 | CHST3 | carbohydrate sulfotransferase 3 | 9615 | VGNC:39255 | Inparanoid, OMA, EggNOG |
| Horse | 100063554 | CHST3 | carbohydrate sulfotransferase 3 | 9796 | VGNC:16537 | Inparanoid, OMA, EggNOG |
| Cow | 506758 | CHST3 | carbohydrate sulfotransferase 3 | 9913 | VGNC:27345 | Inparanoid, OMA, EggNOG |
| Pig | 100151968 | CHST3 | carbohydrate sulfotransferase 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010061 | CHST3 | carbohydrate sulfotransferase 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 396018 | CHST3 | carbohydrate sulfotransferase 3 | 9031 | CGNC:49608 | Inparanoid, OMA |
| Anole lizard | 100568098 | chst3 | carbohydrate sulfotransferase 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100492673 | chst3 | carbohydrate (chondroitin 6) sulfotransferase 3 | 8364 | XB-GENE-993289 | OMA, EggNOG |
| Zebrafish | 559721 | chst3a | carbohydrate (chondroitin 6) sulfotransferase 3a | 7955 | ZDB-GENE-090312-180 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.