Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | ADP-ribosylation factor 6 |
|---|
Gene and Protein Information
| Gene ID | 382 |
|---|---|
| Uniprot Accession IDs | P62330 P26438 Q6FGZ2 |
| Ensembl ID | ENSP00000298316 |
| Family | Belongs to the small GTPase superfamily. Arf family. |
| Sequence | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 11845 | Arf6 | ADP-ribosylation factor 6 | 10090 | MGI:99435 | Inparanoid, OMA, EggNOG |
| Rat | 79121 | Arf6 | ADP-ribosylation factor 6 | 10116 | RGD:621279 | Inparanoid, OMA |
| Dog | 490679 | ARF6 | ADP ribosylation factor 6 | 9615 | VGNC:38031 | Inparanoid, OMA, EggNOG |
| Horse | 100065920 | ARF6 | ADP ribosylation factor 6 | 9796 | VGNC:15446 | Inparanoid, OMA, EggNOG |
| Cow | 100294979 | ARF6 | ADP ribosylation factor 6 | 9913 | VGNC:26061 | Inparanoid, OMA, EggNOG |
| Pig | 780425 | ARF6 | ADP ribosylation factor 6 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024405 | ARF6 | ADP ribosylation factor 6 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100077992 | ARF6 | ADP ribosylation factor 6 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 428927 | ARF6 | ADP ribosylation factor 6 | 9031 | CGNC:53514 | Inparanoid, OMA |
| Anole lizard | 100562975 | arf6 | ADP ribosylation factor 6 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448503 | arf6.2 | ADP ribosylation factor 6 | 8364 | XB-GENE-967358 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100003206 | arf6b | ADP-ribosylation factor 6b | 7955 | ZDB-GENE-030131-9056 | Inparanoid, OMA |
| C. elegans | 191608 | arf-6 | ADP-Ribosylation Factor related | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36699 | Arf51F | ADP ribosylation factor at 51F | 7227 | FBgn0013750 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.