Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Probable G-protein coupled receptor 174 |
|---|
Gene and Protein Information
| Gene ID | 84636 |
|---|---|
| Uniprot Accession IDs | Q9BXC1 Q2M3F7 |
| Ensembl ID | ENSP00000276077 |
| Symbol | FKSG79 GPCR17 LYPSR3 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100613557 | GPR174 | G protein-coupled receptor 174 | 9598 | VGNC:12374 | OMA, EggNOG |
| Mouse | 213439 | Gpr174 | G protein-coupled receptor 174 | 10090 | MGI:2685222 | Inparanoid, OMA, EggNOG |
| Rat | 302373 | Gpr174 | G protein-coupled receptor 174 | 10116 | RGD:1564689 | Inparanoid, OMA, EggNOG |
| Dog | 100683878 | GPR174 | G protein-coupled receptor 174 | 9615 | VGNC:41417 | Inparanoid, OMA, EggNOG |
| Horse | 100071745 | GPR174 | G protein-coupled receptor 174 | 9796 | VGNC:18528 | Inparanoid, OMA, EggNOG |
| Cow | 781056 | GPR174 | G protein-coupled receptor 174 | 9913 | VGNC:29571 | Inparanoid, OMA, EggNOG |
| Pig | 102160665 | GPR174 | G protein-coupled receptor 174 | 9823 | OMA, EggNOG | |
| Opossum | 100020404 | GPR174 | G protein-coupled receptor 174 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | GPR174 | G protein-coupled receptor 174 [Source:HGNC Symbol;Acc:HGNC:30245] | 9258 | OMA, EggNOG | ||
| Chicken | 422146 | GPR174 | G protein-coupled receptor 174 | 9031 | CGNC:3016 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563634 | gpr174 | G protein-coupled receptor 174 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | gpr174 | G protein-coupled receptor 174 [Source:Xenbase;Acc:XB-GENE-994529] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100151331 | gpr174 | G protein-coupled receptor 174 | 7955 | ZDB-GENE-100930-1 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Probable G-protein coupled receptor 174
protein / G-protein coupled receptor / Class A rhodopsin like / Probable G-protein coupled receptor 174
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.