Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Elongation factor 1-gamma |
|---|
Gene and Protein Information
| Gene ID | 1937 |
|---|---|
| Uniprot Accession IDs | P26641 B4DTG2 Q6PJ62 Q6PK31 Q96CU2 Q9P196 EF-1-gamma |
| Ensembl ID | ENSP00000331901 |
| Symbol | EF1G EF1G GIG35 |
| Sequence | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451253 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9598 | VGNC:11344 | OMA, EggNOG |
| Macaque | 722274 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9544 | OMA, EggNOG | |
| Mouse | 67160 | Eef1g | eukaryotic translation elongation factor 1 gamma | 10090 | MGI:1914410 | Inparanoid, OMA, EggNOG |
| Rat | 293725 | Eef1g | eukaryotic translation elongation factor 1 gamma | 10116 | RGD:1302939 | Inparanoid, OMA, EggNOG |
| Dog | 611396 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100009686 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9796 | VGNC:17431 | Inparanoid, OMA, EggNOG |
| Cow | 326581 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9913 | VGNC:28334 | Inparanoid, OMA, EggNOG |
| Pig | 397022 | EEF1G | eukaryotic translation elongation factor 1 gamma | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011874 | EEF1G | eukaryotic translation elongation factor 1 gamma | 13616 | OMA, EggNOG | |
| Xenopus | 394875 | eef1g | eukaryotic translation elongation factor 1 gamma | 8364 | XB-GENE-975013 | Inparanoid, OMA, EggNOG |
| Zebrafish | 195822 | eef1g | eukaryotic translation elongation factor 1 gamma | 7955 | ZDB-GENE-020423-3 | Inparanoid, OMA |
| Fruitfly | 44791 | Ef1gamma | CG11901 gene product from transcript CG11901-RC | 7227 | FBgn0029176 | Inparanoid, EggNOG |
| S.cerevisiae | 856059 | CAM1 | translation elongation factor EF1B gamma | 4932 | S000005969 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.